SPOT-Contact: Accurate prediction of protein contact maps by coupling residual two-dimensional bidirectional long short-term memory with convolutional neural networks

2001-02-10 Jack Hanson

Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.

## Example output

E-mail address (optional):
Target (optional):
Input your protein Sequences:	Maximum: 10 sequences at a time, less than 750AA each (FASTA format)
>Example: 6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP

Sparks Lab

Search

SPOT-Contact: Accurate prediction of protein contact maps by coupling residual two-dimensional bidirectional long short-term memory with convolutional neural networks