SPOT-1D-Single: Improving the Single-Sequence-Based Prediction of Protein Secondary Structure, Backbone Angles, Solvent Accessibility and Half-Sphere Exposures using a Large Training Set and Ensembled Deep Learning

2020-02-10

Our resources are limited. If you wish to run several batches per day please make use of the downloadable package or contact the administrator directly.

Standalone Program Available to Run Locally at:

SPOT-1D-Single-local

The Dataset’s Available at:

Dataset

E-mail address:
Target (optional):
Input your protein Sequences:	Maximum: 100 sequences at a time. Single Line Sequence only and “>prot_id”only (FASTA format)
>6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP

Sparks Lab

Search

SPOT-1D-Single: Improving the Single-Sequence-Based Prediction of Protein Secondary Structure, Backbone Angles, Solvent Accessibility and Half-Sphere Exposures using a Large Training Set and Ensembled Deep Learning

Standalone Program Available to Run Locally at:

The Dataset’s Available at: