SPOT-1D-LM:Reaching Alignment-profile-based Accuracy in Predicting Protein Secondary and Tertiary Structural Properties without Alignment

2020-02-10

Currently, the Webserver is down until further notice. Please refer to the GITHUB for the local standalone.

Standalone Program Available to Run Locally at:

E-mail address:
Target (optional):
Input your protein Sequences:	Maximum: 100 sequences at a time. Single Line Sequence only and “>prot_id”only (FASTA format)
>6KIL_A RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP